PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc09g066060.1.1
Common NameLOC101244525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HB-other
Protein Properties Length: 249aa    MW: 28795.3 Da    PI: 8.49
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc09g066060.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.26e-182677556
                        SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        ++++ eq+++Le++F+k+++p++++ ++L ++ gL+ +qVk+WFqN+R++ k
  Solyc09g066060.1.1 26 HRHSMEQIQRLEAFFKKCPHPDEDQQKQLGREAGLDHKQVKFWFQNKRTQTK 77
                        57899********************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-18677IPR009057Homeodomain-like
SuperFamilySSF466898.36E-17880IPR009057Homeodomain-like
PROSITE profilePS5007114.9161979IPR001356Homeobox domain
SMARTSM003891.3E-122183IPR001356Homeobox domain
PfamPF000461.7E-152677IPR001356Homeobox domain
CDDcd000866.95E-132680No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MTGSGEEPAG EPSNSQNRSE RHGQYHRHSM EQIQRLEAFF KKCPHPDEDQ QKQLGREAGL  60
DHKQVKFWFQ NKRTQTKTQN ERSINNALRK EKERFLCENK AMKEAMKNIM CPKCDGLPIG  120
KEERERNLEN MKTENQLLTE QYEKVSNLIS HVVGRPYVMD SNLAPQKSTL RSTSNSSDGT  180
LLNQEICGSL IRYPPLLPEN NHNNNNVHTH SLMSPSPHEH DEYHLDSRRR KIMFDTAVAS  240
MNEMVKLR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0109301e-80Solanum lycopersicum DNA, chromosome 8, clone: C08SLe0034G06, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010326539.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T588e-47ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLK4CUN20.0K4CUN2_SOLLC; Uncharacterized protein
STRINGSolyc09g066060.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13886814
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17320.12e-42homeodomain GLABROUS 9
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]